PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10013218m
Common NameCICLE_v10013218mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family S1Fa-like
Protein Properties Length: 90aa    MW: 9781.63 Da    PI: 10.4018
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10013218mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA134.42.7e-422289370
             S1FA  3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                     v+ + akG+nPGlivllvvgglllvfl+gnyily+yaqk+lPP+kkkPvskkk+k+e+lkqGv++PGe
  Ciclev10013218m 22 VKDAGAKGFNPGLIVLLVVGGLLLVFLIGNYILYMYAQKTLPPKKKKPVSKKKMKKERLKQGVSAPGE 89
                     566789*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046891.0E-402689IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MDEEFEFGDK APPSFDRVGN TVKDAGAKGF NPGLIVLLVV GGLLLVFLIG NYILYMYAQK  60
TLPPKKKKPV SKKKMKKERL KQGVSAPGE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.197911e-145abscission zone| flower| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006428828.12e-57hypothetical protein CICLE_v10013218mg
RefseqXP_006480642.12e-57PREDICTED: DNA-binding protein S1FA
SwissprotP425532e-17S1FA1_ORYSJ; DNA-binding protein S1FA1
TrEMBLV4S3V42e-57V4S3V4_9R
STRINGPOPTR_0016s08890.18e-29(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769